Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: Q9KWU7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 393-461
Organism: Thermus aquaticus
Interaction Mode:  H-Mj L-Mj 

Sequence:
QFKDETNPLSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLI
TSLAAYARV
Structures of the domain Q9KWU7 393-461
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 I 393-461 None
4xls X-ray 4.01 I 393-461 None
4xls X-ray 4.01 C 393-461 None
4xls X-ray 4.01 C 393-461 None
5tjg X-ray 2.6 C 393-461 None
1l9z X-ray 6.5 C 393-461 None
4xlr X-ray 4.3 C 393-461 None
4xlr X-ray 4.3 I 393-461 None
4xlq X-ray 4.6 C 393-461 None
4xlq X-ray 4.6 I 393-461 None
4xlp X-ray 4 C 393-461 None
4xlp X-ray 4 I 393-461 None
4xln X-ray 4 C 393-461  H-Mj 
4xln X-ray 4 I 393-461  H-Mj L-Mj 


© NPIDB team 2003 - 2019

text