Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: Q9KWU8
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 52-179
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
AVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRA
GDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIF
SPVRRVAF
Structures of the domain Q9KWU8 52-179
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xls X-ray 4.01 H 59-154 None
4xls X-ray 4.01 G 59-154 None
4xls X-ray 4.01 G 59-154 None
4xls X-ray 4.01 H 59-154 None
4xls X-ray 4.01 A 59-154 None
4xls X-ray 4.01 B 59-154 None
4xls X-ray 4.01 B 59-154 None
4xls X-ray 4.01 A 59-154 None
5tjg X-ray 2.6 B 59-154 None
5tjg X-ray 2.6 A 59-154 None
1l9z X-ray 6.5 A 59-154 None
1l9z X-ray 6.5 B 59-154 None
4xlr X-ray 4.3 B 59-154 None
4xlr X-ray 4.3 A 59-154 None
4xlr X-ray 4.3 H 59-154 None
4xlr X-ray 4.3 G 59-154 None
4xlq X-ray 4.6 B 59-154 None
4xlq X-ray 4.6 A 59-154 None
4xlq X-ray 4.6 H 59-154 None
4xlq X-ray 4.6 G 59-154 None
4xlp X-ray 4 A 59-154 None
4xlp X-ray 4 B 59-154 None
4xlp X-ray 4 H 59-154 None
4xlp X-ray 4 G 59-154 None
4xln X-ray 4 B 59-154 None
4xln X-ray 4 A 59-154 None
4xln X-ray 4 H 59-154 None
4xln X-ray 4 G 59-154 None


© NPIDB team 2003 - 2019

text