Pfam domain
Pfam family: MarR_2 (PF12802.9)
Uniprot AC: Q9KYU1
RecName: Putative MarR-family transcriptional repressor
Begin-End: 38-99
Organism: Streptomyces coelicolor
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
AGMPHVYYGLLVKLAESPRRRLRMTELAKYAKITRSRLSHAVARLEKNGWVRREDCPSDK
RG
Structures of the domain Q9KYU1 38-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3zpl X-ray 2.8 A 38-99  H-Bb H-Mj S-Bb L-Bb L-Mn 
3zpl X-ray 2.8 B 38-99  H-Bb H-Mj S-Bb L-Bb L-Mn 
3zpl X-ray 2.8 E 38-99  H-Bb H-Mj S-Bb L-Bb L-Mn 
3zpl X-ray 2.8 F 38-99  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text