Pfam domain
Pfam family: GatB_Yqey (PF02637.17)
Uniprot AC: Q9LCX2
RecName: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
Begin-End: 319-393
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
RFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTS
RVAKSLLPEVLEGQD
Structures of the domain Q9LCX2 319-393
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kfu X-ray 3 I 330-391 None
3kfu X-ray 3 F 330-395 None


© NPIDB team 2003 - 2019

text