Pfam domain
Pfam family: AP2 (PF00847.19)
Uniprot AC: Q9LSX0
RecName: Ethylene-responsive transcription factor ERF096
Begin-End: 13-65
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
GKYRGVRRRPWGKYAAEIRDSRKHGERVWLGTFDTAEEAARAYDQAAYSMRGQ
Structures of the domain Q9LSX0 13-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5wx9 X-ray 1.76 A 14-64 None


© NPIDB team 2003 - 2019

text