Pfam domain
Pfam family: HHH_8 (PF14716.5)
Uniprot AC: Q9NP87
RecName: DNA-directed DNA/RNA polymerase mu
Begin-End: 153-218
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSRV
VQELLE
Structures of the domain Q9NP87 153-218
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vz9 X-ray 1.65 A 156-218 None
5tyv X-ray 1.93 A 156-218 None
5vzg X-ray 1.85 A 156-218 None
5tyx X-ray 1.95 A 156-218 None
5tyf X-ray 1.97 A 156-218 None
5tyu X-ray 2.05 A 156-218 None
5tyg X-ray 1.73 A 156-218 None
5tws X-ray 1.85 A 156-218 None
4ycx X-ray 2.1 A 156-218 None
4m04 X-ray 1.9 A 156-218 None
5txx X-ray 1.95 A 156-218 None
5vzb X-ray 1.5 A 156-218 None
5vze X-ray 1.51 A 156-218 None
5txz X-ray 1.65 A 156-218 None
5tyb X-ray 1.85 A 156-218 None
4lzg X-ray 1.6 A 156-218 None
5tyw X-ray 1.88 A 156-218 None
5vz8 X-ray 1.6 A 156-218 None
5twq X-ray 1.8 A 156-218 None
5tye X-ray 2.05 A 156-218 None
5vz7 X-ray 1.55 A 156-218 None
4m0a X-ray 1.85 A 156-218 None
5vza X-ray 1.5 A 156-218 None
5vzi X-ray 1.5 A 156-218 None
5tyc X-ray 2.1 A 156-218 None
5vzd X-ray 1.6 A 156-218 None
5vzf X-ray 1.65 A 156-218 None
4yd2 X-ray 2.47 A 156-218 None
4yd1 X-ray 1.75 A 156-218 None
5tyz X-ray 1.98 A 156-218 None
5vzc X-ray 1.55 A 156-218 None
5tyd X-ray 1.9 A 156-218 None
5tyy X-ray 1.93 A 156-218 None
5twp X-ray 2 A 156-218 None
5vzh X-ray 1.95 A 156-218 None
5twr X-ray 1.9 A 156-218 None


© NPIDB team 2003 - 2019

text