Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.5)
Uniprot AC: Q9NP87
RecName: DNA-directed DNA/RNA polymerase mu
Begin-End: 430-493
Organism: Homo sapiens
Interaction Mode:   

Sequence:
ALLGWTGSKLFQRELRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPP
EQRN
Structures of the domain Q9NP87 430-493
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vz9 X-ray 1.65 A 430-493 None
5tyv X-ray 1.93 A 430-493 None
5vzg X-ray 1.85 A 430-493 None
5tyx X-ray 1.95 A 430-493 None
5tyf X-ray 1.97 A 430-493 None
5tyu X-ray 2.05 A 430-493 None
5tyg X-ray 1.73 A 430-493 None
5tws X-ray 1.85 A 430-493 None
4ycx X-ray 2.1 A 430-493 None
4m04 X-ray 1.9 A 430-493 None
5txx X-ray 1.95 A 430-493 None
5vzb X-ray 1.5 A 430-493 None
5vze X-ray 1.51 A 430-493 None
5txz X-ray 1.65 A 430-493 None
5tyb X-ray 1.85 A 430-493 None
4lzg X-ray 1.6 A 430-493 None
5tyw X-ray 1.88 A 430-493 None
5vz8 X-ray 1.6 A 430-493 None
5twq X-ray 1.8 A 430-493 None
5tye X-ray 2.05 A 430-493 None
5vz7 X-ray 1.55 A 430-493 None
4m0a X-ray 1.85 A 430-493 None
5vza X-ray 1.5 A 430-493 None
5vzi X-ray 1.5 A 430-493 None
5tyc X-ray 2.1 A 430-493 None
5vzd X-ray 1.6 A 430-493 None
5vzf X-ray 1.65 A 430-493 None
4yd2 X-ray 2.47 A 430-493 None
4yd1 X-ray 1.75 A 430-493 None
5tyz X-ray 1.98 A 430-493 None
5vzc X-ray 1.55 A 430-493 None
5tyd X-ray 1.9 A 430-493 None
5tyy X-ray 1.93 A 430-493 None
5twp X-ray 2 A 430-493 None
5vzh X-ray 1.95 A 430-493 None
5twr X-ray 1.9 A 430-493 None


© NPIDB team 2003 - 2019

text