Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: Q9NRX2
RecName: 39S ribosomal protein L17, mitochondrial
Begin-End: 28-125
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYGKLGDTNERAMRMADFWLTEKDLIP
KLFQVLAPRYKDQTGGYTRMLQIPNRSLDRAKMAVIEY
Structures of the domain Q9NRX2 28-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 O 28-125 None
5oom X-ray 3.03 O 28-125 None


© NPIDB team 2003 - 2019

text