Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: Q9NWU5
RecName: 39S ribosomal protein L22, mitochondrial
Begin-End: 69-173
Organism: Homo sapiens
Interaction Mode:   

Sequence:
HCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNV
EFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLV
Structures of the domain Q9NWU5 69-173
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 T 75-178 None
5oom X-ray 3.03 T 75-157 None


© NPIDB team 2003 - 2019

text