Pfam domain
Pfam family: Ribosomal_L35p (PF01632.18)
Uniprot AC: Q9NZE8
RecName: 39S ribosomal protein L35, mitochondrial
Begin-End: 102-162
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKM
T
Structures of the domain Q9NZE8 102-162
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 3 102-161 None
5oom X-ray 3.03 3 102-161 None


© NPIDB team 2003 - 2019

text