Pfam domain
Pfam family: Ribosomal_L36 (PF00444.17)
Uniprot AC: Q9P0J6
RecName: 39S ribosomal protein L36, mitochondrial
Begin-End: 67-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQ
Structures of the domain Q9P0J6 67-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 4 67-102 None


© NPIDB team 2003 - 2019

text