Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: Q9P0M9
RecName: 39S ribosomal protein L27, mitochondrial
Begin-End: 42-114
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTK
EVYVPHPRNTEAV
Structures of the domain Q9P0M9 42-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j7y X-ray 3.4 W 43-101 None
5oom X-ray 3.03 W 43-101 None


© NPIDB team 2003 - 2019

text