Pfam domain
Pfam family: zf-CXXC (PF02008.22)
Uniprot AC: Q9P0U4
RecName: CXXC-type zinc finger protein 1
Begin-End: 164-208
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
RSARMCGECEACRRTEDCGHCDFCRDMKKFGGPNKIRQKCRLRQC
Structures of the domain Q9P0U4 164-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3qmc X-ray 2.1 A 169-212  H-Bb L-Bb L-Mj 
3qmb X-ray 2.06 A 168-212  H-Bb L-Bb L-Mj 
3qmg X-ray 2.3 A 166-208  L-Bb L-Mj 
3qmh X-ray 2.5 A 166-208  H-Mj L-Bb L-Mj 
3qmi X-ray 2.1 A 166-208  L-Bb L-Mj 
3qmd X-ray 1.9 A 169-212  L-Bb L-Mj 


© NPIDB team 2003 - 2021

text