Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: Q9P6H9
RecName: DNA-binding protein reb1
Begin-End: 313-357
Organism: Schizosaccharomyces pombe
Interaction Mode:  H-Bb H-Mj 

Sequence:
RCVWSKEEDEELRKNVVEHGKCWTKIGRKMARMPNDCRDRWRDVV
Structures of the domain Q9P6H9 313-357
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5eyb X-ray 2.7 A 313-356  H-Bb H-Mj 


© NPIDB team 2003 - 2020

text