Pfam domain
Pfam family: YTH (PF04146.14)
Uniprot AC: Q9QY02
RecName: YTH domain-containing protein 1
Begin-End: 358-496
Organism: Rattus norvegicus
Interaction Mode:   

Sequence:
ARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFAR
LSSESHHGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIG
RDGQEIELECGTQLCLLFP
Structures of the domain Q9QY02 358-496
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2mtv NMR A 358-495 None


© NPIDB team 2003 - 2019

text