Pfam domain
Pfam family: HIN (PF02760.14)
Uniprot AC: Q9R002
RecName: Interferon-activable protein 202
Begin-End: 58-223
Organism: Mus musculus
Interaction Mode:  S-Bb L-Bb 

Sequence:
HEKPMTVMVLTATEPFNYKEGKENMFHATVATESQYYRVKVFNMDLKEKFTENKFITISK
YFNSSGILEINETATVSEAAPNQIIEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVE
KKKVNDKSITFKIKDNEDNIKVVWDKKQHNINYEKGDKLQLFSFHL
Structures of the domain Q9R002 58-223
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jbk X-ray 2.96 A 15-180 None
4jbk X-ray 2.96 C 15-180 None
4jbk X-ray 2.96 D 15-162 None
4jbk X-ray 2.96 A 15-184 None
4jbk X-ray 2.96 A 15-182 None
4jbk X-ray 2.96 B 13-180 None
4l5r X-ray 1.87 C 58-223  S-Bb L-Bb 
4l5s X-ray 2.94 A 58-223 None
4l5s X-ray 2.94 B 58-223 None
4l5s X-ray 2.94 A 57-222 None
4l5s X-ray 2.94 B 57-222 None
4lnq X-ray 2 B 58-223  S-Bb L-Bb 
4lnq X-ray 2 A 58-223  S-Bb L-Bb 


© NPIDB team 2003 - 2019

text