Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: Q9RSH2
RecName: 50S ribosomal protein L34
Begin-End: 1-44
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
MKRTYQPNNRKRAKTHGFRARMKTKSGRNILARRRAKGRHQLTV
Structures of the domain Q9RSH2 1-44
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 2 1-44 None
1nwx X-ray 3.5 2 1-44 None
2zjr X-ray 2.91 2 1-44 None
1xbp X-ray 3.5 2 1-44 None
1nkw X-ray 3.1 2 1-44 None
3cf5 X-ray 3.3 2 1-44 None
1sm1 X-ray 3.42 2 1-44 None
3pio X-ray 3.25 2 1-44 None
2zjp X-ray 3.7 2 1-44 None
4ioc X-ray 3.6 2 1-44 None
3pip X-ray 3.45 2 1-44 None
4ioa X-ray 3.2 2 1-44 None
4io9 X-ray 3.2 2 1-44 None
2zjq X-ray 3.3 2 1-44 None
4wfn X-ray 3.54 2 1-44 None
3dll X-ray 3.5 2 1-44 None
5dm6 X-ray 2.9 2 1-44 None
5jvg X-ray 3.43 2 1-44 None
5jvh X-ray 3.58 2 1-44 None
5dm7 X-ray 3 2 1-44 None
4u67 X-ray 3.65 2 1-44 None


© NPIDB team 2003 - 2019

text