Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: Q9RSJ5
RecName: 50S ribosomal protein L17
Begin-End: 20-116
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
LARAQATALLREGRIQTTLTKAKELRPFVEQLITTAKGGDLHSRRLVAQDIHDKDVVRKV
MDEVAPKYAERPGGYTRILRVGTRRGDGVTMALIELV
Structures of the domain Q9RSJ5 20-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 L 20-116 None
1nwx X-ray 3.5 L 20-116 None
2zjr X-ray 2.91 K 20-115 None
1xbp X-ray 3.5 L 20-116 None
1nkw X-ray 3.1 L 20-116 None
3cf5 X-ray 3.3 K 20-115 None
1sm1 X-ray 3.42 L 20-116 None
3pio X-ray 3.25 K 20-115 None
2zjp X-ray 3.7 K 20-115 None
4ioc X-ray 3.6 K 20-115 None
3pip X-ray 3.45 K 20-115 None
4ioa X-ray 3.2 K 20-115 None
4io9 X-ray 3.2 K 20-115 None
2zjq X-ray 3.3 K 20-115 None
4wfn X-ray 3.54 K 20-115 None
3dll X-ray 3.5 K 20-115 None
5dm6 X-ray 2.9 K 20-115 None
5jvg X-ray 3.43 K 20-115 None
5jvh X-ray 3.58 K 20-115 None
5dm7 X-ray 3 K 20-115 None
4u67 X-ray 3.65 K 20-115 None


© NPIDB team 2003 - 2019

text