Pfam domain
Pfam family: Ribosomal_L27A (PF00828.18)
Uniprot AC: Q9RSK9
RecName: 50S ribosomal protein L15
Begin-End: 26-142
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
TDKTAGRGHKGQKSRSGAGKGAFFEGGRSRLIARLPKRGFNNVGTTYEVVKLSQLQDLED
TTFDRDTLEAYRLVRRKNRPVKLLASGEISRAVTVHVDAASAAAIKAVEAAGGRVVL
Structures of the domain Q9RSK9 26-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 J 28-141 None
1nwx X-ray 3.5 J 28-141 None
2zjr X-ray 2.91 I 28-141 None
1xbp X-ray 3.5 J 28-141 None
1nkw X-ray 3.1 J 28-141 None
3cf5 X-ray 3.3 I 28-141 None
1sm1 X-ray 3.42 J 28-141 None
3pio X-ray 3.25 I 28-141 None
2zjp X-ray 3.7 I 28-141 None
4ioc X-ray 3.6 I 28-141 None
3pip X-ray 3.45 I 28-141 None
4ioa X-ray 3.2 I 28-141 None
4io9 X-ray 3.2 I 28-141 None
2zjq X-ray 3.3 I 28-141 None
4wfn X-ray 3.54 I 28-141 None
3dll X-ray 3.5 I 28-141 None
5dm6 X-ray 2.9 I 28-141 None
5jvg X-ray 3.43 I 28-141 None
5jvh X-ray 3.58 I 28-141 None
5dm7 X-ray 3 I 28-141 None
4u67 X-ray 3.65 I 28-141 None


© NPIDB team 2003 - 2019

text