Pfam domain
Pfam family: Ribosomal_L18p (PF00861.21)
Uniprot AC: Q9RSL2
RecName: 50S ribosomal protein L18
Begin-End: 4-114
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
ATTIRRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSAALKSGN
KTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAAREGGLDF
Structures of the domain Q9RSL2 4-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 M 6-114 None
1nwx X-ray 3.5 M 6-114 None
2zjr X-ray 2.91 L 8-111 None
1xbp X-ray 3.5 M 6-114 None
1nkw X-ray 3.1 M 6-114 None
3cf5 X-ray 3.3 L 8-111 None
1sm1 X-ray 3.42 M 6-114 None
3pio X-ray 3.25 L 8-111 None
2zjp X-ray 3.7 L 8-111 None
4ioc X-ray 3.6 L 8-111 None
3pip X-ray 3.45 L 8-111 None
4ioa X-ray 3.2 L 8-111 None
4io9 X-ray 3.2 L 8-111 None
2zjq X-ray 3.3 L 8-111 None
4wfn X-ray 3.54 L 8-111 None
3dll X-ray 3.5 L 8-111 None
5dm6 X-ray 2.9 L 8-111 None
5jvg X-ray 3.43 L 8-111 None
5jvh X-ray 3.58 L 8-111 None
5dm7 X-ray 3 L 8-111 None
4u67 X-ray 3.65 L 8-111 None


© NPIDB team 2003 - 2019

text