Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: Q9RSL3
RecName: 50S ribosomal protein L6
Begin-End: 90-165
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
RGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVR
KVRKPDAYHGKGVRFV
Structures of the domain Q9RSL3 90-165
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 E 91-163 None
1nwx X-ray 3.5 E 91-163 None
2zjr X-ray 2.91 E 91-163 None
1xbp X-ray 3.5 E 91-163 None
1nkw X-ray 3.1 E 91-163 None
3cf5 X-ray 3.3 E 91-163 None
1sm1 X-ray 3.42 E 91-163 None
3pio X-ray 3.25 E 91-163 None
2zjp X-ray 3.7 E 91-163 None
4ioc X-ray 3.6 E 91-163 None
3pip X-ray 3.45 E 91-163 None
4ioa X-ray 3.2 E 91-163 None
4io9 X-ray 3.2 E 91-163 None
2zjq X-ray 3.3 E 91-163 None
4wfn X-ray 3.54 E 91-163 None
3dll X-ray 3.5 E 91-163 None
5dm6 X-ray 2.9 E 91-163 None
5jvg X-ray 3.43 E 91-163 None
5jvh X-ray 3.58 E 91-163 None
5dm7 X-ray 3 E 91-163 None
4u67 X-ray 3.65 E 91-163 None


© NPIDB team 2003 - 2019

text