Pfam domain
Pfam family: Ribosomal_L33 (PF00471.19)
Uniprot AC: Q9RSS4
RecName: 50S ribosomal protein L33
Begin-End: 8-54
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
IIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKK
Structures of the domain Q9RSS4 8-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 1 8-54 None
1nwx X-ray 3.5 1 8-54 None
2zjr X-ray 2.91 1 8-54 None
1xbp X-ray 3.5 1 8-54 None
1nkw X-ray 3.1 1 8-54 None
3cf5 X-ray 3.3 1 8-54 None
1sm1 X-ray 3.42 1 8-54 None
3pio X-ray 3.25 1 8-54 None
2zjp X-ray 3.7 1 8-54 None
4ioc X-ray 3.6 1 8-54 None
3pip X-ray 3.45 1 8-54 None
4ioa X-ray 3.2 1 8-54 None
4io9 X-ray 3.2 1 8-54 None
2zjq X-ray 3.3 1 8-54 None
4wfn X-ray 3.54 1 8-54 None
3dll X-ray 3.5 1 8-54 None
5dm6 X-ray 2.9 1 8-48 None
5jvg X-ray 3.43 1 8-54 None
5jvh X-ray 3.58 1 8-54 None
5dm7 X-ray 3 1 8-48 None
4u67 X-ray 3.65 1 8-54 None


© NPIDB team 2003 - 2019

text