Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: Q9RSS7
RecName: 50S ribosomal protein L11
Begin-End: 1-65
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
MKKVAGIVKLQLPAGKATPAPPVGPALGQYGANIMEFTKAFNAQTADKGDAIIPVEITIY
ADRSF
Structures of the domain Q9RSS7 1-65
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 G 8-65 None
1nwx X-ray 3.5 G 8-65 None
1xbp X-ray 3.5 G 8-65 None
1nkw X-ray 3.1 G 8-65 None
3cf5 X-ray 3.3 F 8-65 None
1sm1 X-ray 3.42 G 8-65 None
2zjp X-ray 3.7 F 8-65 None
2zjq X-ray 3.3 F 8-65 None
5dm6 X-ray 2.9 F 8-65 None
5dm7 X-ray 3 F 8-65 None


© NPIDB team 2003 - 2019

text