Pfam domain
Pfam family: Ribosomal_L11 (PF00298.18)
Uniprot AC: Q9RSS7
RecName: 50S ribosomal protein L11
Begin-End: 70-138
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
KTPPMSYLIRKAAGIGKGSSTPNKAKVGKLNWDQVLEIAKTKMPDLNAGSVEAAANTVAG
TARSMGVTV
Structures of the domain Q9RSS7 70-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 G 70-138 None
1nwx X-ray 3.5 G 70-138 None
2zjr X-ray 2.91 F 75-138 None
1xbp X-ray 3.5 G 70-138 None
1nkw X-ray 3.1 G 70-138 None
3cf5 X-ray 3.3 F 70-138 None
1sm1 X-ray 3.42 G 70-138 None
3pio X-ray 3.25 F 75-136 None
2zjp X-ray 3.7 F 70-138 None
4ioc X-ray 3.6 F 75-138 None
3pip X-ray 3.45 F 75-136 None
4ioa X-ray 3.2 F 75-138 None
4io9 X-ray 3.2 F 75-138 None
2zjq X-ray 3.3 F 70-138 None
3dll X-ray 3.5 F 71-139 None
5dm6 X-ray 2.9 F 70-138 None
5jvg X-ray 3.43 F 75-136 None
5dm7 X-ray 3 F 70-138 None


© NPIDB team 2003 - 2019

text