Pfam domain
Pfam family: Ribosomal_L35p (PF01632.18)
Uniprot AC: Q9RSW6
RecName: 50S ribosomal protein L35
Begin-End: 2-62
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLM
L
Structures of the domain Q9RSW6 2-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 3 2-62 None
1nwx X-ray 3.5 3 2-62 None
2zjr X-ray 2.91 3 2-62 None
1xbp X-ray 3.5 3 2-62 None
1nkw X-ray 3.1 3 2-62 None
3cf5 X-ray 3.3 3 2-62 None
1sm1 X-ray 3.42 3 2-62 None
3pio X-ray 3.25 3 6-62 None
2zjp X-ray 3.7 3 2-62 None
4ioc X-ray 3.6 3 2-62 None
3pip X-ray 3.45 3 6-62 None
4ioa X-ray 3.2 3 2-62 None
4io9 X-ray 3.2 3 2-62 None
2zjq X-ray 3.3 3 2-62 None
4wfn X-ray 3.54 3 6-62 None
3dll X-ray 3.5 3 2-62 None
5dm6 X-ray 2.9 3 2-62 None
5jvg X-ray 3.43 3 6-62 None
5jvh X-ray 3.58 3 6-62 None
5dm7 X-ray 3 3 2-62 None
4u67 X-ray 3.65 3 6-62 None


© NPIDB team 2003 - 2019

text