Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: Q9RSW7
RecName: 50S ribosomal protein L20
Begin-End: 3-109
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
RAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRLWI
QRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKAL
Structures of the domain Q9RSW7 3-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 O 3-109 None
1nwx X-ray 3.5 O 3-109 None
2zjr X-ray 2.91 N 3-109 None
1xbp X-ray 3.5 O 3-109 None
1nkw X-ray 3.1 O 3-109 None
3cf5 X-ray 3.3 N 3-109 None
1sm1 X-ray 3.42 O 3-109 None
3pio X-ray 3.25 N 3-109 None
2zjp X-ray 3.7 N 3-109 None
4ioc X-ray 3.6 N 3-109 None
3pip X-ray 3.45 N 3-109 None
4ioa X-ray 3.2 N 3-109 None
4io9 X-ray 3.2 N 3-109 None
2zjq X-ray 3.3 N 3-109 None
4wfn X-ray 3.54 N 3-109 None
3dll X-ray 3.5 N 3-109 None
5dm6 X-ray 2.9 N 3-109 None
5jvg X-ray 3.43 N 3-109 None
5jvh X-ray 3.58 N 3-109 None
5dm7 X-ray 3 N 3-109 None
4u67 X-ray 3.65 N 3-109 None


© NPIDB team 2003 - 2019

text