Pfam domain
Pfam family: Trigger_N (PF05697.12)
Uniprot AC: Q9RT21
RecName: Trigger factor
Begin-End: 10-109
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
NKVEFKVSVPAAEVNRAYDQVWAGLARDVRVPGFRPGKAPRKVIENRVGKGYVESQVRDR
LLETHYSQGLRELGLNLVDATVDPQDVQSGQAFEFTVKGE
Structures of the domain Q9RT21 10-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2d3o X-ray 3.35 1 10-107 None


© NPIDB team 2003 - 2019

text