Pfam domain
Pfam family: Ribosomal_L31 (PF01197.17)
Uniprot AC: Q9RW44
RecName: 50S ribosomal protein L31
Begin-End: 1-64
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
MQKDLHPKAVPCKIIYQGQVVMETMSTRPEIHVDVWSGVHPFWTGEERFLDTEGRVDKFN
KRFG
Structures of the domain Q9RW44 1-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 Y 1-64 None
1nwx X-ray 3.5 Y 1-64 None
1xbp X-ray 3.5 Y 1-64 None
1nkw X-ray 3.1 Y 1-64 None
1sm1 X-ray 3.42 Y 1-64 None


© NPIDB team 2003 - 2019

text