Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: Q9RWB4
RecName: 50S ribosomal protein L19
Begin-End: 11-109
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
ELLRGIEQDHTRQLPDFRPGDTVRVDTKVREGNRTRSQAFEGVVIAINGSGSRKSFTVRK
ISFGEGVERVFPFASPLVNQVTIVERGKVRRAKLYYLRE
Structures of the domain Q9RWB4 11-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2zjr X-ray 2.91 M 13-109 None
3cf5 X-ray 3.3 M 13-109 None
3pio X-ray 3.25 M 13-109 None
2zjp X-ray 3.7 M 13-109 None
4ioc X-ray 3.6 M 13-109 None
3pip X-ray 3.45 M 13-109 None
4ioa X-ray 3.2 M 13-109 None
4io9 X-ray 3.2 M 13-109 None
2zjq X-ray 3.3 M 13-109 None
4wfn X-ray 3.54 M 13-109 None
3dll X-ray 3.5 M 13-109 None
5dm6 X-ray 2.9 M 13-106 None
5jvh X-ray 3.58 M 13-109 None
4u67 X-ray 3.65 M 13-109 None


© NPIDB team 2003 - 2019

text