Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: Q9RWB4
RecName: 50S ribosomal protein L19
Begin-End: 11-115
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
ELLRGIEQDHTRQLPDFRPGDTVRVDTKVREGNRTRSQAFEGVVIAINGSGSRKSFTVRK
ISFGEGVERVFPFASPLVNQVTIVERGKVRRAKLYYLRELRGKAA
Structures of the domain Q9RWB4 11-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5dm7 X-ray 3 M 13-106 None


© NPIDB team 2003 - 2019

text