Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: Q9RWB4
RecName: 50S ribosomal protein L19
Begin-End: 11-120
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
ELLRGIEQDHTRQLPDFRPGDTVRVDTKVREGNRTRSQAFEGVVIAINGSGSRKSFTVRK
ISFGEGVERVFPFASPLVNQVTIVERGKVRRAKLYYLRELRGKAARIKSD
Structures of the domain Q9RWB4 11-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 N 13-119 None
1nwx X-ray 3.5 N 13-119 None
1xbp X-ray 3.5 N 13-119 None
1nkw X-ray 3.1 N 13-119 None
1sm1 X-ray 3.42 N 13-119 None
5jvg X-ray 3.43 M 13-119 None


© NPIDB team 2003 - 2019

text