Pfam domain
Pfam family: UDG (PF03167.18)
Uniprot AC: Q9RWH9
RecName: Uracil-DNA glycosylase
Begin-End: 68-230
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
RYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPGVRVPPSLRNIYKELTEDIPGFVAPKH
GYLRSWAEQGVLLLNAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYA
RKKKKLITGKNHVVIESGHPSPLSEQYFFGTRPFSKTNEALEK
Structures of the domain Q9RWH9 68-230
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uqm X-ray 1.35 A 74-226 None


© NPIDB team 2003 - 2020

text