Pfam domain
Pfam family: Ribosomal_L25p (PF01386.18)
Uniprot AC: Q9RX88
RecName: 50S ribosomal protein L25
Begin-End: 3-83
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
LTAKPRTPKQKLDESMIAAVAYNKENNVSFALDRKAFDRAFRQQSTTGLFDITVEGGETF
PALVKAVQMDKRKRAPIHVDF
Structures of the domain Q9RX88 3-83
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1njp X-ray 3.5 T 12-83 None
1nwy X-ray 3.3 T 12-83 None
1nwx X-ray 3.5 T 12-83 None
2zjr X-ray 2.91 S 11-83 None
1xbp X-ray 3.5 T 12-83 None
1nkw X-ray 3.1 T 12-83 None
1njm X-ray 3.6 T 12-83 None
3cf5 X-ray 3.3 S 11-83 None
1sm1 X-ray 3.42 T 12-83 None
3pio X-ray 3.25 S 11-83 None
2zjp X-ray 3.7 S 11-83 None
4ioc X-ray 3.6 S 11-83 None
3pip X-ray 3.45 S 11-83 None
4ioa X-ray 3.2 S 11-83 None
4io9 X-ray 3.2 S 11-83 None
2zjq X-ray 3.3 S 11-83 None
4wfn X-ray 3.54 S 11-83 None
3dll X-ray 3.5 S 11-83 None
5dm6 X-ray 2.9 S 11-83 None
5jvg X-ray 3.43 S 11-83 None
5jvh X-ray 3.58 S 11-83 None
5dm7 X-ray 3 S 11-83 None
4u67 X-ray 3.65 S 11-83 None


© NPIDB team 2003 - 2019

text