Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: Q9RXJ1
RecName: 50S ribosomal protein L24
Begin-End: 51-114
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
VNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPETGKATRVRKQIVDGKKVRVAVAS
GKTI
Structures of the domain Q9RXJ1 51-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 S 51-114 None
1nwx X-ray 3.5 S 51-114 None
2zjr X-ray 2.91 R 51-112 None
1xbp X-ray 3.5 S 51-114 None
1nkw X-ray 3.1 S 51-114 None
3cf5 X-ray 3.3 R 51-112 None
1sm1 X-ray 3.42 S 51-114 None
3pio X-ray 3.25 R 51-112 None
2zjp X-ray 3.7 R 51-112 None
4ioc X-ray 3.6 R 51-112 None
3pip X-ray 3.45 R 51-112 None
4ioa X-ray 3.2 R 51-112 None
4io9 X-ray 3.2 R 51-112 None
2zjq X-ray 3.3 R 51-112 None
4wfn X-ray 3.54 R 51-112 None
3dll X-ray 3.5 R 51-112 None
5dm6 X-ray 2.9 R 51-112 None
5jvg X-ray 3.43 R 51-112 None
5jvh X-ray 3.58 R 51-112 None
5dm7 X-ray 3 R 51-112 None
4u67 X-ray 3.65 R 51-112 None
2d3o X-ray 3.35 S 51-112 None


© NPIDB team 2003 - 2019

text