Pfam domain
Pfam family: Ribosomal_L14 (PF00238.18)
Uniprot AC: Q9RXJ2
RecName: 50S ribosomal protein L14
Begin-End: 2-133
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
IMPQSRLDVADNSGAREIMCIRVLNSGIGGKGLTTGGGGNKRYAHVGDIIVASVKDAAPR
GAVKAGDVVKAVVVRTSHAIKRADGSTIRFDRNAAVIINNQGEPRGTRVFGPVARELRDR
RFMKIVSLAPEV
Structures of the domain Q9RXJ2 2-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 I 2-133 None
1nwx X-ray 3.5 I 2-133 None
2zjr X-ray 2.91 H 1-134 None
1xbp X-ray 3.5 I 2-133 None
1nkw X-ray 3.1 I 2-133 None
3cf5 X-ray 3.3 H 1-134 None
1sm1 X-ray 3.42 I 2-133 None
3pio X-ray 3.25 H 1-134 None
2zjp X-ray 3.7 H 1-134 None
4ioc X-ray 3.6 H 1-134 None
3pip X-ray 3.45 H 1-134 None
4ioa X-ray 3.2 H 1-134 None
4io9 X-ray 3.2 H 1-134 None
2zjq X-ray 3.3 H 1-134 None
4wfn X-ray 3.54 H 1-134 None
3dll X-ray 3.5 H 1-134 None
5dm6 X-ray 2.9 H 1-134 None
5jvg X-ray 3.43 H 1-134 None
5jvh X-ray 3.58 H 1-134 None
5dm7 X-ray 3 H 1-134 None
4u67 X-ray 3.65 H 1-134 None


© NPIDB team 2003 - 2019

text