Pfam domain
Pfam family: Ribosomal_L16 (PF00252.17)
Uniprot AC: Q9RXJ5
RecName: 50S ribosomal protein L16
Begin-End: 7-130
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
TKFRKQFRGRMTGDAKGGDYVAFGDYGLIAMEPAWIKSNQIEACRIVMSRHFRRGGKIYI
RIFPDKPVTKKPAETRMGKGKGAVEYWVSVVKPGRVMFEVAGVTEEQAKEAFRLAGHKLP
IQTK
Structures of the domain Q9RXJ5 7-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1njp X-ray 3.5 K 8-131 None
1nwy X-ray 3.3 K 8-131 None
1nwx X-ray 3.5 K 8-131 None
1y69 X-ray 3.33 K 6-133 None
2zjr X-ray 2.91 J 6-133 None
1xbp X-ray 3.5 K 8-131 None
1nkw X-ray 3.1 K 8-131 None
1njm X-ray 3.6 K 8-131 None
3cf5 X-ray 3.3 J 6-133 None
1sm1 X-ray 3.42 K 8-131 None
3pio X-ray 3.25 J 6-133 None
2zjp X-ray 3.7 J 6-133 None
4ioc X-ray 3.6 J 6-133 None
3pip X-ray 3.45 J 6-133 None
4ioa X-ray 3.2 J 6-133 None
4io9 X-ray 3.2 J 6-133 None
2zjq X-ray 3.3 J 6-133 None
4wfn X-ray 3.54 J 6-133 None
3dll X-ray 3.5 J 6-133 None
5dm6 X-ray 2.9 J 6-133 None
5jvg X-ray 3.43 J 6-133 None
5jvh X-ray 3.58 J 6-133 None
5dm7 X-ray 3 J 6-133 None
4u67 X-ray 3.65 J 6-133 None


© NPIDB team 2003 - 2019

text