Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: Q9RXJ7
RecName: 50S ribosomal protein L22
Begin-End: 26-129
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
AVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFIPRSASEPVAKVLNSAKANALHNDEM
LEDRLFVKEAYVDAGPTLKRLIPRARGSANIIKKRTSHITIIVA
Structures of the domain Q9RXJ7 26-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j5a X-ray 3.5 L 26-128 None
1k01 X-ray 3.5 L 26-128 None
1ond X-ray 3.4 Q 26-128 None
1jzy X-ray 3.5 L 26-128 None
1nwy X-ray 3.3 Q 26-128 None
1nwx X-ray 3.5 Q 26-128 None
2zjr X-ray 2.91 P 26-128 None
1jzz X-ray 3.8 L 26-128 None
1xbp X-ray 3.5 Q 26-128 None
1nkw X-ray 3.1 Q 26-128 None
1jzx X-ray 3.1 L 26-128 None
3cf5 X-ray 3.3 P 26-128 None
1sm1 X-ray 3.42 Q 26-128 None
3pio X-ray 3.25 P 26-128 None
2zjp X-ray 3.7 P 26-128 None
4ioc X-ray 3.6 P 26-128 None
3pip X-ray 3.45 P 26-128 None
4ioa X-ray 3.2 P 26-128 None
4io9 X-ray 3.2 P 26-128 None
2zjq X-ray 3.3 P 26-128 None
4wfn X-ray 3.54 P 26-131 None
3dll X-ray 3.5 P 26-128 None
5dm6 X-ray 2.9 P 26-128 None
5jvg X-ray 3.43 P 26-128 None
5jvh X-ray 3.58 P 26-128 None
5dm7 X-ray 3 P 26-128 None
4u67 X-ray 3.65 P 26-131 None


© NPIDB team 2003 - 2019

text