Pfam domain
Pfam family: Ribosomal_L2_C (PF03947.17)
Uniprot AC: Q9RXJ9
RecName: 50S ribosomal protein L2
Begin-End: 126-251
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
KLGNALPLRFVPVGAVVHALELVPGKGAQLARSAGTSVQVQGKESDYVIVRLPSGELRRV
HSECYATIGAVGNAEHKNIVLGKAGRSRWLGRKPHQRGSAMNPVDHPHGGGEGRTGAGRV
PVTPWG
Structures of the domain Q9RXJ9 126-251
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 A 127-251 None
1nwx X-ray 3.5 A 127-251 None
2zjr X-ray 2.91 A 127-251 None
1xbp X-ray 3.5 A 127-251 None
1nkw X-ray 3.1 A 127-251 None
3cf5 X-ray 3.3 A 127-251 None
1sm1 X-ray 3.42 A 127-251 None
3pio X-ray 3.25 A 128-252 None
2zjp X-ray 3.7 A 127-251 None
4ioc X-ray 3.6 A 127-251 None
3pip X-ray 3.45 A 128-252 None
4ioa X-ray 3.2 A 127-251 None
4io9 X-ray 3.2 A 127-251 None
2zjq X-ray 3.3 A 127-251 None
4wfn X-ray 3.54 A 127-251 None
3dll X-ray 3.5 A 127-249 None
5dm6 X-ray 2.9 A 127-251 None
5jvg X-ray 3.43 A 127-251 None
5jvh X-ray 3.58 A 127-251 None
5dm7 X-ray 3 A 127-251 None
4u67 X-ray 3.65 A 127-251 None


© NPIDB team 2003 - 2019

text