Pfam domain
Pfam family: Ribosomal_L23 (PF00276.19)
Uniprot AC: Q9RXK0
RecName: 50S ribosomal protein L23
Begin-End: 5-90
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
DILQAPVISEKAYSAMERGVYSFWVSPKATKTEIKDAIQQAFGVRVIGISTMNVPGKRKR
VGRFIGQRNDRKKAIVRLAEGQSIEA
Structures of the domain Q9RXK0 5-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2aar X-ray 3.5 R 5-89 None
1nwy X-ray 3.3 R 5-89 None
1nwx X-ray 3.5 R 5-89 None
2zjr X-ray 2.91 Q 5-89 None
1xbp X-ray 3.5 R 5-89 None
1nkw X-ray 3.1 R 5-89 None
3cf5 X-ray 3.3 Q 5-89 None
1sm1 X-ray 3.42 R 5-89 None
3pio X-ray 3.25 Q 5-89 None
2zjp X-ray 3.7 Q 5-89 None
4ioc X-ray 3.6 Q 5-89 None
3pip X-ray 3.45 Q 5-89 None
4ioa X-ray 3.2 Q 5-89 None
4io9 X-ray 3.2 Q 5-89 None
2zjq X-ray 3.3 Q 5-89 None
4wfn X-ray 3.54 Q 5-89 None
3dll X-ray 3.5 Q 5-89 None
5dm6 X-ray 2.9 Q 5-89 None
5jvg X-ray 3.43 Q 5-89 None
5jvh X-ray 3.58 Q 5-89 None
5dm7 X-ray 3 Q 5-89 None
4u67 X-ray 3.65 Q 5-89 None
2d3o X-ray 3.35 R 5-89 None


© NPIDB team 2003 - 2019

text