Pfam domain
Pfam family: Ribosomal_L4 (PF00573.21)
Uniprot AC: Q9RXK1
RecName: 50S ribosomal protein L4
Begin-End: 19-198
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
LPEVNSGVLHEVVTWQLASRRRGTASTRTRAQVSKTGRKMYGQKGTGNARHGDRSVPTFV
GGGVAFGPKPRSYDYTLPRQVRQLGLAMAIASRQEGGKLVAVDGFDIADAKTKNFISWAK
QNGLDGTEKVLLVTDDENTRRAARNVSWVSVLPVAGVNVYDILRHDRLVIDAAALEIVEE
Structures of the domain Q9RXK1 19-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1j5a X-ray 3.5 K 21-198 None
1k01 X-ray 3.5 K 21-198 None
1jzy X-ray 3.5 K 21-198 None
1nwy X-ray 3.3 C 21-198 None
1nwx X-ray 3.5 C 21-198 None
2zjr X-ray 2.91 C 21-198 None
1jzz X-ray 3.8 K 21-198 None
1xbp X-ray 3.5 C 21-198 None
1nkw X-ray 3.1 C 21-198 None
1jzx X-ray 3.1 K 21-198 None
3cf5 X-ray 3.3 C 21-198 None
1sm1 X-ray 3.42 C 21-198 None
3pio X-ray 3.25 C 21-194 None
2zjp X-ray 3.7 C 21-198 None
4ioc X-ray 3.6 C 21-198 None
3pip X-ray 3.45 C 21-194 None
4ioa X-ray 3.2 C 21-198 None
4io9 X-ray 3.2 C 21-198 None
2zjq X-ray 3.3 C 21-198 None
4wfn X-ray 3.54 C 21-194 None
3dll X-ray 3.5 C 21-198 None
5dm6 X-ray 2.9 C 21-198 None
5jvg X-ray 3.43 C 21-194 None
5jvh X-ray 3.58 C 21-194 None
5dm7 X-ray 3 C 21-198 None
4u67 X-ray 3.65 C 21-194 None


© NPIDB team 2003 - 2019

text