Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: Q9RXK2
RecName: 50S ribosomal protein L3
Begin-End: 86-181
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
PDGDSVNVDIFAEGEKIDATGTSKGKGTQGVMKRWNFAGGPASHGSKKWHRRPGSIGQRK
TPGRVYKGKRMAGHMGMERVTVQNLEVVEIRAGENL
Structures of the domain Q9RXK2 86-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ogn X-ray 3.56 B 94-179 None
2ogo X-ray 3.66 B 94-179 None
1nwy X-ray 3.3 B 94-179 None
1nwx X-ray 3.5 B 94-179 None
2ogm X-ray 3.5 B 94-179 None
2zjr X-ray 2.91 B 94-179 None
1xbp X-ray 3.5 B 94-179 None
1nkw X-ray 3.1 B 94-179 None
3cf5 X-ray 3.3 B 94-179 None
1sm1 X-ray 3.42 B 94-179 None
3pio X-ray 3.25 B 94-179 None
2zjp X-ray 3.7 B 94-179 None
4ioc X-ray 3.6 B 94-179 None
3pip X-ray 3.45 B 94-179 None
4ioa X-ray 3.2 B 94-179 None
4io9 X-ray 3.2 B 94-179 None
2zjq X-ray 3.3 B 94-179 None
4wfn X-ray 3.54 B 94-179 None
3dll X-ray 3.5 B 94-179 None
5dm6 X-ray 2.9 B 94-179 None
5jvg X-ray 3.43 B 94-179 None
5jvh X-ray 3.58 B 94-179 None
5dm7 X-ray 3 B 94-179 None
4u67 X-ray 3.65 B 94-179 None


© NPIDB team 2003 - 2019

text