Pfam domain
Pfam family: Ribosomal_L13 (PF00572.17)
Uniprot AC: Q9RXY1
RecName: 50S ribosomal protein L13
Begin-End: 40-164
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
NWVVVDASGVPLGRLATLIASRIRGKHRPDFTPNMIQGDFVVVINAAQVALTGKKLDDKV
YTRYTGYQGGLKTETAREALSKHPERVIEHAVFGMLPKGRQGRAMHTRLKVYAGETHPHS
AQKPQ
Structures of the domain Q9RXY1 40-164
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 H 40-164 None
1nwx X-ray 3.5 H 40-164 None
2zjr X-ray 2.91 G 40-164 None
1xbp X-ray 3.5 H 40-164 None
1nkw X-ray 3.1 H 40-164 None
3cf5 X-ray 3.3 G 40-164 None
1sm1 X-ray 3.42 H 40-164 None
3pio X-ray 3.25 G 40-164 None
2zjp X-ray 3.7 G 40-164 None
4ioc X-ray 3.6 G 40-164 None
3pip X-ray 3.45 G 40-164 None
4ioa X-ray 3.2 G 40-164 None
4io9 X-ray 3.2 G 40-164 None
2zjq X-ray 3.3 G 40-164 None
4wfn X-ray 3.54 G 40-164 None
3dll X-ray 3.5 G 40-164 None
5dm6 X-ray 2.9 G 40-164 None
5jvg X-ray 3.43 G 40-164 None
5jvh X-ray 3.58 G 40-164 None
5dm7 X-ray 3 G 40-164 None
4u67 X-ray 3.65 G 40-164 None


© NPIDB team 2003 - 2019

text