Pfam domain
Pfam family: Ribosomal_L9_N (PF01281.18)
Uniprot AC: Q9RY49
RecName: 50S ribosomal protein L9
Begin-End: 1-46
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
MQVILLEPSRLGKTGEVVSVKDGYARNWLIPQGLAVSATRTNMKTL
Structures of the domain Q9RY49 1-46
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 F 1-46 None
1nwx X-ray 3.5 F 1-46 None
1xbp X-ray 3.5 F 1-46 None
1nkw X-ray 3.1 F 1-46 None
1sm1 X-ray 3.42 F 1-46 None


© NPIDB team 2003 - 2019

text