Pfam domain
Pfam family: Ribosomal_L21p (PF00829.20)
Uniprot AC: Q9RY64
RecName: 50S ribosomal protein L21
Begin-End: 1-98
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGEDAGKYTVQAEV
VEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGI
Structures of the domain Q9RY64 1-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 P 1-98 None
1nwx X-ray 3.5 P 1-98 None
2zjr X-ray 2.91 O 5-98 None
1xbp X-ray 3.5 P 1-98 None
1nkw X-ray 3.1 P 1-98 None
3cf5 X-ray 3.3 O 5-98 None
1sm1 X-ray 3.42 P 1-98 None
3pio X-ray 3.25 O 5-98 None
2zjp X-ray 3.7 O 5-98 None
4ioc X-ray 3.6 O 5-98 None
3pip X-ray 3.45 O 5-98 None
4ioa X-ray 3.2 O 5-98 None
4io9 X-ray 3.2 O 5-98 None
2zjq X-ray 3.3 O 5-98 None
4wfn X-ray 3.54 O 5-98 None
3dll X-ray 3.5 O 5-98 None
5dm6 X-ray 2.9 O 5-98 None
5jvg X-ray 3.43 O 2-98 None
5jvh X-ray 3.58 O 5-98 None
5dm7 X-ray 3 O 5-98 None
4u67 X-ray 3.65 O 5-98 None


© NPIDB team 2003 - 2019

text