Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: Q9RY65
RecName: 50S ribosomal protein L27
Begin-End: 12-81
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
NGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFALSDGKVVFIN
KGKGARFISI
Structures of the domain Q9RY65 12-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3pio X-ray 3.25 T 12-80 None
3pip X-ray 3.45 T 12-80 None
4wfn X-ray 3.54 T 12-80 None
5jvg X-ray 3.43 T 12-80 None
5jvh X-ray 3.58 T 12-80 None
4u67 X-ray 3.65 T 12-80 None


© NPIDB team 2003 - 2019

text