Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: Q9RY65
RecName: 50S ribosomal protein L27
Begin-End: 2-81
Organism: Deinococcus radiodurans
Interaction Mode:   

Sequence:
AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFA
LSDGKVVFINKGKGARFISI
Structures of the domain Q9RY65 2-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1nwy X-ray 3.3 U 2-80 None
1nwx X-ray 3.5 U 2-80 None
1y69 X-ray 3.33 U 2-80 None
2zjr X-ray 2.91 T 2-80 None
1xbp X-ray 3.5 U 2-80 None
1nkw X-ray 3.1 U 2-80 None
3cf5 X-ray 3.3 T 2-80 None
1sm1 X-ray 3.42 U 2-80 None
2zjp X-ray 3.7 T 2-80 None
4ioc X-ray 3.6 T 2-80 None
4ioa X-ray 3.2 T 2-80 None
4io9 X-ray 3.2 T 2-80 None
2zjq X-ray 3.3 T 2-80 None
3dll X-ray 3.5 T 2-80 None
5dm6 X-ray 2.9 T 2-80 None
5dm7 X-ray 3 T 2-80 None


© NPIDB team 2003 - 2019

text