Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: Q9SNB4
RecName: Transcription factor LUX
Begin-End: 146-196
Organism: Arabidopsis thaliana
Interaction Mode:   

Sequence:
RLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYR
Structures of the domain Q9SNB4 146-196
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5lxu X-ray 2.14 A 146-196 None


© NPIDB team 2003 - 2020

text