Pfam domain
Pfam family: Ribosomal_S17_N (PF16205.4)
Uniprot AC: Q9TXA6
RecName: Ribosomal protein S11
Begin-End: 1-54
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
MHRPSRKHVNKSGHIRYSKKIGLGFKTPAKALNGKYIDRKCPFTSNVVIRGRIL
Structures of the domain Q9TXA6 1-54
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 U 18-86 None


© NPIDB team 2003 - 2019

text