Pfam domain
Pfam family: Ribosomal_S17 (PF00366.19)
Uniprot AC: Q9TXA6
RecName: Ribosomal protein S11
Begin-End: 56-124
Organism: Leishmania donovani
Interaction Mode:   

Sequence:
GVVHSTKMHRTIIIRRNYLHFIKKYQRYQKRHKSLAVHCSPAFDPKQGDEVVIGQCRPLS
KTIRYNVLE
Structures of the domain Q9TXA6 56-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6az1 X-ray 2.7 U 88-156 None


© NPIDB team 2003 - 2019

text