Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.5)
Uniprot AC: Q9U6N3
RecName: DNA polymerase beta
Begin-End: 283-375
Organism: Leishmania infantum
Interaction Mode:   

Sequence:
AMLTFTGSKNFNVIMRQAAISKGYLLNEYGLFKLGTPEEARALYERIGIRGKNAGEELGV
PKDELEDKRVEVRSEQDVFDVLGMPYAKPENRD
Structures of the domain Q9U6N3 283-375
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4p4m X-ray 1.92 A 283-375 None
4p4p X-ray 2.3 A 283-375 None
4p4o X-ray 2.3 A 283-375 None


© NPIDB team 2003 - 2020

text